PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G0946
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 387aa    MW: 43232.6 Da    PI: 6.5113
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G0946genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEd +++ +v ++G+g+W++++++ g++R++k+c++rw +yl
      Gh_D13G0946 14 KGLWTEEEDAKILAYVSKHGTGNWTAVPKKAGLRRCGKSCRLRWTNYL 61
                     678*******************************************97 PP

2Myb_DNA-binding50.25.7e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T++E+el++++++ lG++ W+ Ia+ ++ gRt++++k++w++
      Gh_D13G0946  67 RESFTPQEEELIIRLHAALGSR-WSIIAQQLP-GRTDNDVKNYWNT 110
                      679*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.472965IPR017930Myb domain
SuperFamilySSF466891.29E-3011108IPR009057Homeodomain-like
SMARTSM007172.6E-151363IPR001005SANT/Myb domain
PfamPF002495.2E-171461IPR001005SANT/Myb domain
CDDcd001672.35E-121761No hitNo description
Gene3DG3DSA:1.10.10.604.2E-2565116IPR009057Homeodomain-like
SMARTSM007171.8E-1566114IPR001005SANT/Myb domain
PROSITE profilePS5129420.31166116IPR017930Myb domain
PfamPF002491.1E-1467110IPR001005SANT/Myb domain
CDDcd001672.29E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048658Biological Processanther wall tapetum development
GO:0052545Biological Processcallose localization
GO:0055046Biological Processmicrogametogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MVRPPCCDKL NVKKGLWTEE EDAKILAYVS KHGTGNWTAV PKKAGLRRCG KSCRLRWTNY  60
LRPDLKRESF TPQEEELIIR LHAALGSRWS IIAQQLPGRT DNDVKNYWNT KLRKKLSEMG  120
IDPVTHKPFS QVLADYGNIG GLLKSRTRIG SLNREMKNSF MIKPEPHPPQ PAIATEGFSN  180
INNRRVMKTM ASPGIEPIQE NFFPSSNINQ HAATCASLDL LSQLQAIKLV TEASNYGGYQ  240
IISPQFPNQY TLSLSSPSSS SSTSSTCSTT AQEKAGLAFS WRDFLLEDAF LPYDHHPQGQ  300
DHIPEFESKD IAPQNHSGNE TSAEHIDDDK NIIINNNSRV LSGMDSELLS YGIQASSSTE  360
SSFVAAMLDQ ENEMFSEFAN LLEDPCY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-30141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012448458.10.0PREDICTED: transcription factor MYB86
RefseqXP_012448457.10.0PREDICTED: transcription factor MYB86
RefseqXP_012448456.10.0PREDICTED: transcription factor MYB86
TrEMBLA0A0D2UC280.0A0A0D2UC28_G
STRINGPOPTR_0015s07900.11e-140(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28470.15e-76MYB family protein